PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G111700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 240aa    MW: 27305.2 Da    PI: 6.7178
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G111700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.8e-18449147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        rg W + Ede+l+++v+++G+++W++Ia++++ gR++k+c++rw++ 
  Sevir.9G111700.1.p  4 RGHWRPSEDEKLKELVALYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 49
                        899*****************************.***********996 PP

2Myb_DNA-binding52.51.2e-165699146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        r ++++eE+ell+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Sevir.9G111700.1.p 56 RSPFSEEEEELLLASHRVHGNR-WAVIARLFP-GRTDNAVKNHWHV 99
                        789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.97154IPR017930Myb domain
SMARTSM007171.5E-15352IPR001005SANT/Myb domain
PfamPF002498.1E-18449IPR001005SANT/Myb domain
SuperFamilySSF466895.24E-29497IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.7E-27557IPR009057Homeodomain-like
CDDcd001671.55E-13748No hitNo description
PROSITE profilePS5129419.90255105IPR017930Myb domain
SMARTSM007174.5E-1555103IPR001005SANT/Myb domain
PfamPF002496.9E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2058104IPR009057Homeodomain-like
CDDcd001672.56E-57198No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MCTRGHWRPS EDEKLKELVA LYGPHNWNAI AEKLQGRSGK SCRLRWFNQL DPRINRSPFS  60
EEEEELLLAS HRVHGNRWAV IARLFPGRTD NAVKNHWHVI MARRCRERMR MSNKRGAGGV  120
PSAAAAGAAE DENNPRNAKR PRPDSSSMAS LLDKYRREFA VPFAINHDSN KEDYCSTTNE  180
EEDTNKSVEF YDFLQVNANS SDTKCGSSIE EQEENRDDQA EGQVQFIDFL EVGAASHRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-3321055108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138142KRPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7281920.0KJ728192.1 Zea mays clone pUT6466 MYB transcription factor (MYB37) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981953.11e-180PREDICTED: transcriptional activator Myb isoform X1
TrEMBLK4AEE91e-180K4AEE9_SETIT; Uncharacterized protein
STRINGSi037256m1e-180(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73410.12e-70myb domain protein 54